ScamLens analyzed ivvvaaannaaalaaawiiiiifamilly.blogspot.com using 90+ threat intelligence sources and assigned a trust score of 25/100, classifying it as high risk.
Trust Score: 25/100
Risk Level: High Risk
This domain already shows strong risk signals. Stop interacting, preserve the page, chat, phone, and payment evidence, and move into response or reporting immediately.
Quick Answer
This domain already shows strong risk signals. Stop interacting, preserve the page, chat, phone, and payment evidence, and move into response or reporting immediately.
Positive Signals
- + Google Safe Browsing: Safe
- + HTTPS encryption supported
Concerns
- - 3 security sources flagged as suspicious
Score Breakdown
Was this assessment accurate?
ivvvaaannaaalaaawiiiiifamilly.blogspot.com looks like a phishing site
At least one trusted threat-intelligence feed flagged this domain. Treat any credential prompt as hostile.
- Do not enter passwords or card detailsPhishing pages clone legitimate brand UIs to steal credentials. If you already entered them, change those passwords immediately on the real site.
- Close the tab and clear browser data for this domainThis breaks any session cookie the page set and reduces the risk of follow-up phishing prompts.
- Report it so others are protectedOne community report can warn thousands of visitors. Use the button below.
Trust but verify — open this domain on unrelated security services and compare the verdict.
Sign in to run the AI risk analysis
The threat-intelligence signals below are available to everyone. The plain-language AI risk summary is generated on demand for signed-in users — sign in (free) to run it for this domain.
Threat-intelligence sources
Checked across 22 sources — 3 flagged this domain
Show source breakdown
Threat-intelligence sources
Checked across 22 sources — 3 flagged this domain
- safe_browsing clean
- urlhaus clean
- cloudflare_radar clean
- cert_transparency clean
- alienvault_otx clean
- phishstats clean
- phishdestroy flagged
- threatfox clean
- shodan_internetdb clean
- phishtank clean
- rdap clean
- maltiverse clean
- dns_security flagged
- wanted_domains clean
- darkweb clean
- openphish flagged
- scam_blocklist clean
- maltrail clean
- crypto_scam_feed clean
- phishing_army clean
- hagezi_tif clean
- red_flag_domains clean
ScamLens aggregates real-time signals from 90+ commercial and open-source threat-intelligence providers including Google Safe Browsing, VirusTotal, PhishTank, URLhaus, ThreatFox, Cloudflare Radar, OTX, IPQS, GoPlus, Honeypot.is, and more. A flagged signal is evidence; the absence of flags is not proof of safety. Use the signals below alongside community reports to decide.
Advanced Scan
Comprehensive data lookup across premium sources
- Website history verification
- Detailed WHOIS information
- Reverse WHOIS association
- Traffic rank analysis
- Company registration check
AI Deep Investigation
Cross-check the story, claims, and supporting evidence before you decide
- Everything in Advanced Scan
- AI website content analysis
- AI cross-reference verification
- Claim authenticity validation
- Detailed report with evidence
Comprehensive Investigation
Full-spectrum investigation with company deep search & social intelligence
- Everything in Deep Investigation
- AI company background search
- Social media intelligence
- Detailed suspicious point analysis
- Event timeline & entity connections
This analysis is for informational purposes only and does not constitute a legal determination.
Security Sources
Domain Information
- DNSSEC
- Disabled
SSL/TLS Certificate
No data available
Server Information
- IP Address
- 142.250.9.132
- Hosting Provider
- Google LLC
- ASN
- AS15169 Google LLC
- Server Location
- Mountain View, United States
- Organization
- Google LLC
Related Intelligence
Technical Details (DNS / Headers / Subdomains)
DNS Records
Email Security
SPF Not Configured DMARC Not Configured| Type | Value |
|---|---|
| A | 142.250.9.132 |
| AAAA | 2607:f8b0:4002:c2c::84 |
| CNAME | blogspot.l.googleusercontent.com |
HTTP Security Headers
1/6nosniff
Channels / Subdomains
No data available
Community Reports
Log in to report and share your experience
Report & Take Down This Website
High-Risk Signals
The risk signals are strong enough. Move on evidence preservation, reporting, and victim response now
This result is no longer just a normal verification case. Moving the chat, phone, payment, and official-reporting path in parallel is usually more important than waiting for more data.
Recommended First
Move into the victim action plan
If you already paid, logged in, or installed tools, use the action plan first to prioritize containment and evidence work.
Move into the website-reporting flow
Move the site, payment evidence, chat trail, and contact points into the formal reporting path.
Add the chat, DM, and payment-pressure trail
Keep the Telegram, WhatsApp, social DM, and payment-pressure trail in the same timeline.
Check the callback number and SMS
If the actor also used calls, SMS, or one-time codes, verify that phone path next.
The results are based on multiple third-party data sources and AI models. False positives or negatives may occur. This report should not be used as the sole basis for any decision. Please verify with additional sources.
If a loss already happened, move into the response flow now
Delay is the main risk with high-risk domains. Prioritize freezes, credential resets, reporting, and evidence preservation now.
If no loss happened yet, continue with the website-reporting and official-agency paths next.
Related Security Guides
Learn more about how to protect yourself from this type of threat.
Understanding this threat
FAQ
Is ivvvaaannaaalaaawiiiiifamilly.blogspot.com safe to visit?
ivvvaaannaaalaaawiiiiifamilly.blogspot.com received a trust score of 25/100 from ScamLens, indicating several security concerns. 3 threat intelligence sources flagged this domain. Proceed with extreme caution.
Was ivvvaaannaaalaaawiiiiifamilly.blogspot.com flagged by any threat databases?
ivvvaaannaaalaaawiiiiifamilly.blogspot.com was flagged by 3 out of 30+ threat intelligence sources. Specifically flagged by: phishdestroy, dns_security, openphish. The detected threat categories include: general threat.
How old is ivvvaaannaaalaaawiiiiifamilly.blogspot.com?
Registration date information for ivvvaaannaaalaaawiiiiifamilly.blogspot.com is not publicly available through WHOIS records, which can itself be a risk indicator.
Does ivvvaaannaaalaaawiiiiifamilly.blogspot.com use HTTPS and have a valid SSL certificate?
ScamLens could not verify the SSL certificate details for ivvvaaannaaalaaawiiiiifamilly.blogspot.com during this scan. Treat this as unavailable evidence, not as proof that the site is safe or unsafe.
What security headers does ivvvaaannaaalaaawiiiiifamilly.blogspot.com implement?
ivvvaaannaaalaaawiiiiifamilly.blogspot.com is missing important security headers: Content-Security-Policy, X-Frame-Options, X-Content-Type-Options, Strict-Transport-Security, Referrer-Policy, Permissions-Policy. Missing security headers can leave visitors vulnerable to cross-site scripting (XSS) and other web-based attacks.
What does the ScamLens community think about ivvvaaannaaalaaawiiiiifamilly.blogspot.com?
No community votes or reports have been submitted for ivvvaaannaaalaaawiiiiifamilly.blogspot.com yet. You can be the first to share your experience.
Where is ivvvaaannaaalaaawiiiiifamilly.blogspot.com hosted?
ivvvaaannaaalaaawiiiiifamilly.blogspot.com is hosted by Google LLC in Mountain View, United States (ASN: ASAS15169 Google LLC).
Is this report useful?
Use this report to tell others to stop interacting now and move straight into containment, evidence preservation, and reporting.
Forward to your parents — they deserve to browse safely too.
About this analysis
This report is generated from real-time data across 90+ threat intelligence sources, combined with AI analysis and community feedback.
Learn about our scoring methodology | Last analyzed: July 30, 2026