ScamLens
Cached < 6hAnonymous (3/day)

Security Report for snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space

ScamLens analyzed snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space using 90+ threat intelligence sources and assigned a trust score of 72/100, classifying it as safe.

Trust Score: 72/100

Risk Level: Trusted

There is no strongest risk signal at the moment, but that does not automatically clear the case. Continue by checking the actual transaction scenario, company identity, and communication method.

Site Title
snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space
Website meta information unavailable
HTTPS ✓
1
Checked 1 times

Quick Answer

There is no strongest risk signal at the moment, but that does not automatically clear the case. Continue by checking the actual transaction scenario, company identity, and communication method.

Positive Signals

  • + Google Safe Browsing: Safe
  • + HTTPS encryption supported

No concerns found

Score Breakdown

Domain Reputation 50
Threat Intelligence 100
12/13 safeSafeBrowsing OK
Technical Security 60
HTTPS
Community Reputation 50
No community data yet

Was this assessment accurate?

0 say Safe0 say Suspicious
What do you think?
What to do next

snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space looks legitimate

No threat feeds have flagged this domain. Use standard online-safety habits.

Confidence:High
  1. Bookmark the official URL
    Scammers often clone legitimate brands at look-alike domains. A saved bookmark protects you from typos.
  2. Watch for unexpected payment requests
    Even legitimate sites can be hijacked. Treat unsolicited 'urgent payment' prompts as suspicious.
  3. Verify HTTPS + the exact spelling
    Confirm the lock icon, and inspect the domain letter-by-letter before entering passwords or card details.
Cross-check with independent scanners

Trust but verify — open this domain on unrelated security services and compare the verdict.

Sign in to run the AI risk analysis

The threat-intelligence signals below are available to everyone. The plain-language AI risk summary is generated on demand for signed-in users — sign in (free) to run it for this domain.

Threat-intelligence sources

Checked across 22 sources — 1 flagged this domain

Show source breakdown
  • safe_browsing clean
  • urlhaus clean
  • cloudflare_radar clean
  • cert_transparency clean
  • alienvault_otx clean
  • phishstats clean
  • phishdestroy clean
  • threatfox clean
  • shodan_internetdb clean
  • phishtank clean
  • rdap clean
  • maltiverse clean
  • dns_security clean
  • wanted_domains clean
  • darkweb clean
  • maltrail flagged
  • openphish clean
  • scam_blocklist clean
  • crypto_scam_feed clean
  • phishing_army clean
  • hagezi_tif clean
  • red_flag_domains clean

ScamLens aggregates real-time signals from 90+ commercial and open-source threat-intelligence providers including Google Safe Browsing, VirusTotal, PhishTank, URLhaus, ThreatFox, Cloudflare Radar, OTX, IPQS, GoPlus, Honeypot.is, and more. A flagged signal is evidence; the absence of flags is not proof of safety. Use the signals below alongside community reports to decide.

Advanced Scan

Comprehensive data lookup across premium sources

$2.99one-time payment
  • Website history verification
  • Detailed WHOIS information
  • Reverse WHOIS association
  • Traffic rank analysis
  • Company registration check
Recommended

AI Deep Investigation

Cross-check the story, claims, and supporting evidence before you decide

$4.99one-time payment
  • Everything in Advanced Scan
  • AI website content analysis
  • AI cross-reference verification
  • Claim authenticity validation
  • Detailed report with evidence
Most Thorough

Comprehensive Investigation

Full-spectrum investigation with company deep search & social intelligence

$14.99one-time payment
  • Everything in Deep Investigation
  • AI company background search
  • Social media intelligence
  • Detailed suspicious point analysis
  • Event timeline & entity connections

This analysis is for informational purposes only and does not constitute a legal determination.

Security Sources

Google Safe Browsing
Safe
Cloudflare Radar
Safe
URLhaus (abuse.ch) Confidence: Medium
Not Listed
Certificate Transparency Confidence: Low
Not Listed
AlienVault OTX Confidence: Low
Not Listed
PhishStats Confidence: Low
Not Listed
PhishDestroy Confidence: Medium
Not Listed
ThreatFox (abuse.ch) Confidence: Low
Not Listed
Shodan InternetDB Confidence: Low
Not Listed
PhishTank Confidence: Low
Not Listed
RDAP Domain Registration Confidence: Low
Not Listed
Maltiverse Confidence: Low
Not Listed
DNS Security Confidence: Low
Not Listed
Law Enforcement Confidence: Low
Not Listed
darkweb Confidence: Low
Not Listed
Maltrail (stamparm) Confidence: Medium
Unsafe
OpenPhish Confidence: Low
Not Listed
Scam Blocklist (Jarelllama) Confidence: Low
Not Listed
Crypto Scam Feed Confidence: Low
Not Listed
Phishing Army Confidence: Low
Not Listed
HaGeZi Threat Intelligence Confidence: Low
Not Listed
Red Flag Domains Confidence: Low
Not Listed

Domain Information

DNSSEC
Disabled

SSL/TLS Certificate

No data available

Server Information

No data available

Related Intelligence

Technical Details (DNS / Headers / Subdomains)

DNS Records

No data available

HTTP Security Headers

Security header detection was blocked by the target website (e.g. rate limiting or access restriction). Results may be inaccurate.

Channels / Subdomains

No data available

Community Reports

Log in to report and share your experience

...

The results are based on multiple third-party data sources and AI models. False positives or negatives may occur. This report should not be used as the sole basis for any decision. Please verify with additional sources.

Continue with the actual scenario check

If this is a store, investment platform, or recovery service, do not rely on the domain alone. Continue with the matching scenario guide.

Open a scenario guide

If you already paid, logged in, or downloaded files, move into the action plan immediately.

Related Security Guides

Learn more about how to protect yourself from this type of threat.

Understanding this threat

FAQ

Is snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space safe to visit?

snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space received a trust score of 72/100 from ScamLens, based on analysis of 30+ threat intelligence sources. No significant threats were detected. The site appears safe and trustworthy.

Was snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space flagged by any threat databases?

snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space was flagged by 1 out of 30+ threat intelligence sources. Specifically flagged by: maltrail. The detected threat categories include: general threat.

How old is snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space?

Registration date information for snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space is not publicly available through WHOIS records, which can itself be a risk indicator.

Does snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space use HTTPS and have a valid SSL certificate?

ScamLens could not verify the SSL certificate details for snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space during this scan. Treat this as unavailable evidence, not as proof that the site is safe or unsafe.

What security headers does snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space implement?

No security header information was available for snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space.

What does the ScamLens community think about snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space?

No community votes or reports have been submitted for snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space yet. You can be the first to share your experience.

What should I do about snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space?

Based on our analysis, snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space appears safe. You can proceed with normal caution. Always verify URLs manually and avoid clicking suspicious links.

Is this report useful?

Use this report to remind others to verify the shopping, investment, or support scenario instead of treating it as full clearance.

Forward to your parents — they deserve to browse safely too.

About this analysis

This report is generated from real-time data across 90+ threat intelligence sources, combined with AI analysis and community feedback.

Learn about our scoring methodology | Last analyzed: August 4, 2026